Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Pendants
Pendants
40mm Circle Pendant Heart Pendant Long Rectangle Oval Pendant Short Rectangle
Classic Oval Pendant 30x40mm RECYCLED Paint - Various Patt..
Classic Oval Pendant 30x40mm RECYCLED Paint - Various Patt..
£30.00
Heart Pendant RECYCLED Paint - Various Patterns
Heart Pendant RECYCLED Paint - Various Patterns
£22.00
Large 40mm Circle Pendant RECYCLED Paint - Various- 2
Large 40mm Circle Pendant RECYCLED Paint - Various- 2
£35.00
Large 40mm Circle Pendant RECYCLED Paint- 1
Large 40mm Circle Pendant RECYCLED Paint- 1
£35.00
Long Rectangle Pendant RECYCLED Paint - Various Patterns
Long Rectangle Pendant RECYCLED Paint - Various Patterns
£28.00
Short Rectangle Pendant RECYCLED Paint - Various Patterns
Short Rectangle Pendant RECYCLED Paint - Various Patterns
£25.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i